PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.BNM3L
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 122aa    MW: 14099.7 Da    PI: 9.8641
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.BNM3LgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-14241546
                     -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     ++ E++l  +++ ++G++ W++Iar+++ gRt++++k++w++
      Aradu.BNM3L  2 SPHEQQLVMHLHSKWGNR-WSRIARKLP-GRTDNEIKNFWRT 41
                     899***************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.369147IPR017930Myb domain
CDDcd001672.11E-9141No hitNo description
SMARTSM007174.0E-8145IPR001005SANT/Myb domain
SuperFamilySSF466892.34E-11248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-18244IPR009057Homeodomain-like
PfamPF002491.5E-12241IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MSPHEQQLVM HLHSKWGNRW SRIARKLPGR TDNEIKNFWR TQMRKQKAQE KKRAPATTQS  60
SPSSSSTSYQ SSSSSNKDIG EESFYDTGGH NEPLPLWMIM DNQEQEQSKV LFPSSYEPLL  120
TT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015952297.12e-41PREDICTED: transcription factor MYB59-like
RefseqXP_016187323.12e-41PREDICTED: transcription factor MYB59-like
SwissprotQ9LX826e-28MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A0L9TJQ49e-32A0A0L9TJQ4_PHAAN; Uncharacterized protein
STRINGGLYMA11G15180.62e-30(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2924222
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.23e-27myb domain protein 48